PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v0661590.1
Common NameNAO1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WOX
Protein Properties Length: 338aa    MW: 38928.6 Da    PI: 8.4779
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v0661590.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.83.4e-2256115357
                      --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  Lj2g3v0661590.1  56 SRWNPTPEQLRALEELYRRgTRTPSAEQIQQITAQLrrfgKIEGKNVFYWFQNHKARERQ 115
                      7*****************99**************************************97 PP

2Wus_type_Homeobox114.84.1e-3755117365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L+++Gkie+kNVfyWFQN+kaRerqk+
    Lj2g3v0661590.1  55 SSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARERQKR 117
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003899.5E-553120IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.4E-956115IPR009057Homeodomain-like
PfamPF000466.4E-2056115IPR001356Homeobox domain
SuperFamilySSF466891.41E-1256121IPR009057Homeodomain-like
CDDcd000863.38E-657117No hitNo description
PROSITE profilePS5007111.45161116IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MWMVGYNESG AEFNMADYPF NGRKLRPLMP RPIHLLASVT EQNKREFNTP PVVVSSRWNP  60
TPEQLRALEE LYRRGTRTPS AEQIQQITAQ LRRFGKIEGK NVFYWFQNHK ARERQKRRRQ  120
MESEAEGPPR DFESSHHDKK DLGASRTVFE VEQTKNNWPS STNCTSTLAE ESVSIQSAAA  180
KAVVAAECSR TDGWLQFDEG ELQQQRRNFM ERNATWRMMQ FPCPPQPPHF INTPPQYAST  240
TSMATVTAAR LMDQKLIKTH ADLSFFISPH TRENNSIIHL SSFTTEDNVE SQTLQLFPLR  300
NGDGSSENSN QHHKETEISV SAMNAPSQFF EFLPLKKY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.258900.0pod
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ2912500.0JQ291250.1 Lotus japonicus NARROW ORGAN 1 (NAO1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525189.11e-165PREDICTED: WUSCHEL-related homeobox 1-like isoform X1
TrEMBLJ7JYT70.0J7JYT7_LOTJA; NARROW ORGAN 1
STRINGGLYMA05G33850.21e-164(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.15e-61WUSCHEL related homeobox 1
Publications ? help Back to Top
  1. Zhuang LL, et al.
    LATHYROIDES, encoding a WUSCHEL-related Homeobox1 transcription factor, controls organ lateral growth, and regulates tendril and dorsal petal identities in garden pea (Pisum sativum L.).
    Mol Plant, 2012. 5(6): p. 1333-45
    [PMID:22888154]